Proposals for new wikis: Difference between revisions

Content deleted Content added
Stryn (talk | contribs)
m I thought it's automatical
No edit summary
 
(911 intermediate revisions by more than 100 users not shown)
Line 1:
__NEWSECTIONLINK__
{{:Proposals for new wikis/header/{{#ifexist:Proposals for new wikis/header/{{int:lang}}|{{int:lang}}|en}}}}
{| style="width: 100%; border: 3px double #B7C7F7; padding: .3em; background-color: #F3F3FF;"
| colspan="3" style="background-color: #B7C7F7" align="center" | '''Proposals for new wikis'''
|-
|colspan="2" | This page hosts proposals for new Orain wikis. Here you can:
 
<!-- DO NOT EDIT ABOVE! ONLY EDIT HERE WHEN YOU KNOW WHAT YOU ARE DOING! CLICK READ, AND USE BUTTON IN THE PAGE TO REQUEST NEW WIKI! -->
 
== huyenle <small>(Status: Done)</small> ==
* Propose new wikis. If you have an idea for a new wiki, submit it here.
* Wiki ID: huyenle.orain.orgwiki
* Get involved in the process. Help sites get off the ground by defining the types of articles that are wanted and by recruiting editors to help with its launch.
* URL: huyenle.orain.org
* Before requesting a wiki, check out our [[Special:SiteMatrix|current wikis]] to see if we already have one about your topic.
* Type: Public
* A wiki request may be rejected automatically if:
* File uploads: Yes
:* There is no description
* Description: Summarize my ideas and thoughts, collect data, and do some literature review.
:* It may cause legal issues
* Default language: en, vi
:* There is an existing wiki (with certain exceptions in rare cases)
[[User:Huyenle|Huyenle]] ([[User talk:Huyenle|talk]]) 17:26, 7 July 2015 (BST)
 
<small>'''Stewards and wiki creators''': To create the requested wiki, click [{{fullurl:Special:CreateWiki|Special:CreateWiki&wpdbname=huyenle.orain.orgwiki&wpcomment=Wiki+created+per+request+of+{{urlencode:Huyenle}}&wpfounder={{urlencode:Huyenle}}}} here]. Once the wiki has been created, [[Special:Userrights/Huyenle@huyenle.orain.orgwiki|grant the local rights]]. (notify user: [{{fullurl:User talk:{{urlencode:Huyenle}}|action=edit&section=new&preload=Template:Wiki_created}} done] · [{{fullurl:User talk:{{urlencode:Huyenle}}|action=edit&section=new&preload=Wiki_not_created}} not done])</small>
 
{{Done}} [[User:Reception123|Reception123]] ([[User talk:Reception123|talk]]) 06:50, 8 July 2015 (BST)
Archives: [[/Archive 1]] • [[/Archive 2]]
<br>
 
{{Note}} As you have put <code>en, vi</code>, your wiki can't have two languages so I have chosen <code>en</code>. Please tell me if you want to change. --[[User:Reception123|Reception123]] ([[User talk:Reception123|talk]]) 06:50, 8 July 2015 (BST)
<big><big><big><center>Create a wiki now! Click below to get started:</center></big></big></big>
<big><big><center>Make sure to be '''logged in''' before you request a wiki. </center></big></big>
<inputbox>
type=comment
hidden=yes
editintro=Template:Request instructions
preload=Proposals for new wikis/preload
default=Proposals_for_new_wikis
buttonlabel=Request a wiki
</inputbox>
|}
 
== Enmiendas reglamento ley de transparecia <small>(Status: Pending, Issue)</small> ==
<!-- DO NOT EDIT ABOVE! ONLY EDIT HERE WHEN YOU KNOW WHAT YOU ARE DOING! CLICK READ, AND USE BUTTON IN THE PAGE TO REQUEST NEW WIKI! -->
* Wiki ID: enmiendas-reglamento-trasparenciawiki
* URL: enmiendas-reglamento-trasparencia.orain.org
* Type: Public
* File uploads: no
* Description: Xnet presenta: espacio para enmiendas ciudadanas al Real Decreto por el que se aprueba el reglamento de la ley de transparencia, acceso a la información pública y buen gobierno - [On friday the spanish government is going to approve the transparency law, but there is no way for citizens to make amendment on this text]
* Default language: es
[[User:Xnet|Xnet]] ([[User talk:Xnet|talk]]) 19:00, 7 July 2015 (BST)
 
<small>'''Stewards and wiki creators''': To create the requested wiki, click [{{fullurl:Special:CreateWiki|Special:CreateWiki&wpdbname=enmiendas-reglamento-trasparenciawiki&wpcomment=Wiki+created+per+request+of+{{urlencode:Xnet}}&wpfounder={{urlencode:Xnet}}}} here]. Once the wiki has been created, [[Special:Userrights/Xnet@enmiendas-reglamento-trasparenciawiki|grant the local rights]]. (notify user: [{{fullurl:User talk:{{urlencode:Xnet}}|action=edit&section=new&preload=Template:Wiki_created}} done] · [{{fullurl:User talk:{{urlencode:Xnet}}|action=edit&section=new&preload=Wiki_not_created}} not done])</small>
 
:I can't create your wiki because the Wiki ID, is too long. Please make the ID shorter. --[[User:Reception123|Reception123]] ([[User talk:Reception123|talk]]) 06:55, 8 July 2015 (BST)
 
== BAD[SECTOR].PL WikiOceanBlue <small>(Status: Done)</small> ==
* Wiki ID: badsectorwikiOceanwiki
* URL: badsectorOcean.orain.org
* Type: Private
* File uploads: yes
* Description: personal notes on offshore technology - fpso, spar, TLP, semi
* Default language: en
[[User:Hasmi|Hasmi]] ([[User talk:Hasmi|talk]]) 05:45, 8 July 2015 (BST)
 
<small>'''Stewards and wiki creators''': To create the requested wiki, click [{{fullurl:Special:CreateWiki|Special:CreateWiki&wpdbname=Oceanwiki&wpcomment=Wiki+created+per+request+of+{{urlencode:Hasmi}}&wpfounder={{urlencode:Hasmi}}}} here]. Once the wiki has been created, [[Special:Userrights/Hasmi@Oceanwiki|grant the local rights]]. (notify user: [{{fullurl:User talk:{{urlencode:Hasmi}}|action=edit&section=new&preload=Template:Wiki_created}} done] · [{{fullurl:User talk:{{urlencode:Hasmi}}|action=edit&section=new&preload=Wiki_not_created}} not done])</small>
 
{{Done}} [[User:Reception123|Reception123]] ([[User talk:Reception123|talk]]) 06:59, 8 July 2015 (BST)
 
== Vyktory Wiki <small>(Status: Done)</small> ==
* Wiki ID: vyktorywiki
* URL: vyktory.orain.org
* Type: Private
* File uploads: Yes
* Description: The official wiki of the micronation named the Commonwealth of Vyktory.
* Default language: en
[[User:Jarokn|Jarokn]] ([[User talk:Jarokn|talk]]) 15:53, 8 July 2015 (BST)
 
<small>'''Stewards and wiki creators''': To create the requested wiki, click [{{fullurl:Special:CreateWiki|Special:CreateWiki&wpdbname=vyktorywiki&wpcomment=Wiki+created+per+request+of+{{urlencode:Jarokn}}&wpfounder={{urlencode:Jarokn}}}} here]. Once the wiki has been created, [[Special:Userrights/Jarokn@vyktorywiki|grant the local rights]]. (notify user: [{{fullurl:User talk:{{urlencode:Jarokn}}|action=edit&section=new&preload=Template:Wiki_created}} done] · [{{fullurl:User talk:{{urlencode:Jarokn}}|action=edit&section=new&preload=Wiki_not_created}} not done])</small>
 
{{Done}} --[[User:Reception123|Reception123]] ([[User talk:Reception123|talk]]) 16:56, 8 July 2015 (BST)
 
== AVFRK House <small>(Status: Done)</small> ==
* Wiki ID: avfrkwiki
* URL: avfrk.orain.org
* Type: Private
* File uploads: yes
* Description: About a house
* Default language: "en"
[[User:HouseRev|HouseRev]] ([[User talk:HouseRev|talk]]) 17:43, 8 July 2015 (BST)
 
<small>'''Stewards and wiki creators''': To create the requested wiki, click [{{fullurl:Special:CreateWiki|Special:CreateWiki&wpdbname=avfrkwiki&wpcomment=Wiki+created+per+request+of+{{urlencode:HouseRev}}&wpfounder={{urlencode:HouseRev}}}} here]. Once the wiki has been created, [[Special:Userrights/HouseRev@avfrkwiki|grant the local rights]]. (notify user: [{{fullurl:User talk:{{urlencode:HouseRev}}|action=edit&section=new&preload=Template:Wiki_created}} done] · [{{fullurl:User talk:{{urlencode:HouseRev}}|action=edit&section=new&preload=Wiki_not_created}} not done])</small>
 
{{Done}} [[User:Reception123|Reception123]] ([[User talk:Reception123|talk]]) 17:51, 8 July 2015 (BST)
 
== Tanods Wiki <small>(Status: Done)</small> ==
* Wiki ID: tanodswiki
* URL: tanods.orain.org
* Type: Public
* File uploads: yes
* Description: To document the "Tanods" show, A Filipino show about local enforcement volunteers working in a village
* Description: Kompendium wiedzy dotyczącej bezpieczeństwa IT
* Default language: plen
[[User:BadsectorMazodan|BadsectorMazodan]] ([[User talk:BadsectorMazodan|talk]]) 2309:5200, 239 OctoberJuly 20142015 (BST)
 
<small>'''Stewards and wiki creators''': To create the requested wiki, click [{{fullurl:Special:CreateWiki|Special:CreateWiki&wpdbname=badsectorwikitanodswiki&wpcomment=Wiki+created+per+request+of+{{urlencode:BadsectorMazodan}}&wpfounder={{urlencode:BadsectorMazodan}}}} here]. Once the wiki has been created, [[Special:Userrights/BadsectorMazodan@badsectorwikitanodswiki|grant the local rights]]. (notify user: [{{fullurl:User talk:{{urlencode:Mazodan}}|action=edit&section=new&preload=Template:Wiki_created}} done] · [{{fullurl:User talk:{{urlencode:Mazodan}}|action=edit&section=new&preload=Wiki_not_created}} not done])</small>
 
:{{done}} - [[User:Southparkfan|Southparkfan]] ([[User talk:Southparkfan|talk]]) 20:50, 29 October 2014 (GMT)
{{Done}} [[User:Reception123|Reception123]] ([[User talk:Reception123|talk]]) 10:49, 9 July 2015 (BST)
== {{{title}}} <small>(Status: More information requested)</small> ==
 
* Wiki ID: {{{subdomain}}}wiki
== 한국교통 위키 <small>(Status: Done)</small> ==
* URL: {{{subdomain}}}.orain.org
* Wiki ID: kotransitwiki
* Type: {{{type}}}
* URL: kotransit.orain.org
* File uploads: {{{fileuploads}}}
* Type: Public
* Description: {{{description}}}
* File uploads: Yes
* Description: Archiving informations(history) of the transit systems in Korea.
* Default language: ko
[[User:Riemann|Riemann]] ([[User talk:Riemann|talk]]) 15:23, 9 July 2015 (BST)
 
<small>'''Stewards and wiki creators''': To create the requested wiki, click [{{fullurl:Special:CreateWiki|Special:CreateWiki&wpdbname=kotransitwiki&wpcomment=Wiki+created+per+request+of+{{urlencode:Riemann}}&wpfounder={{urlencode:Riemann}}}} here]. Once the wiki has been created, [[Special:Userrights/Riemann@kotransitwiki|grant the local rights]]. (notify user: [{{fullurl:User talk:{{urlencode:Riemann}}|action=edit&section=new&preload=Template:Wiki_created}} done] · [{{fullurl:User talk:{{urlencode:Riemann}}|action=edit&section=new&preload=Wiki_not_created}} not done])</small>
 
{{Done}} [[User:Reception123|Reception123]] ([[User talk:Reception123|talk]]) 15:41, 9 July 2015 (BST)
 
== tetradwiki <small>(Status: Done)</small> ==
* Wiki ID: tetrad.orain.orgwiki
* URL: tetrad.orain.org.orain.org
* Type: public
* File uploads: yes
* Description: Contains the user manual for the causal/statistical software TETRAD
* Default language: en
[[User:LOLincMglymour|LOLincMglymour]] ([[User talk:LOLincMglymour|talk]]) 0021:5326, 249 OctoberJuly 20142015 (BST)
 
<small>'''Stewards and wiki creators''': To create the requested wiki, click [{{fullurl:Special:CreateWiki|Special:CreateWiki&wpdbname={{{subdomain}}}wikitetrad.orain.orgwiki&wpcomment=Wiki+created+per+request+of+{{urlencode:LOLincMglymour}}&wpfounder={{urlencode:LOLincMglymour}}}} here]. Once the wiki has been created, [[Special:Userrights/LOLincMglymour@{{{subdomain}}}wikitetrad.orain.orgwiki|grant the local rights]]. (notify user: [{{fullurl:User talk:{{urlencode:Mglymour}}|action=edit&section=new&preload=Template:Wiki_created}} done] · [{{fullurl:User talk:{{urlencode:Mglymour}}|action=edit&section=new&preload=Wiki_not_created}} not done])</small>
:Please give the title, subdomain, and description of your wiki. [[User:Wynter|Wynter]] ([[User talk:Wynter|talk]]) 16:00, 27 October 2014 (GMT)
 
{{Done}} [[User:Reception123|Reception123]] ([[User talk:Reception123|talk]]) 05:32, 10 July 2015 (BST)
== atmega32 <small>(Status: Done)</small> ==
 
* Wiki ID: atmega32.orain.orgwiki
== The Race Director Software <small>(Status: Done)</small> ==
* URL: atmega32.orain.org.orain.org
* Wiki ID: theracedirectorwiki
* URL: theracedirector.orain.org
* Type: Public
* File uploads: Yes
* Description: This Wiki will be used as a how-to/walkthrough guide for a piece of software for running/biking/triathlon event directors and timers.=
* Default language: en
[[User:Mattave|Mattave]] ([[User talk:Mattave|talk]]) 18:39, 10 July 2015 (BST)
 
<small>'''Stewards and wiki creators''': To create the requested wiki, click [{{fullurl:Special:CreateWiki|Special:CreateWiki&wpdbname=theracedirectorwiki&wpcomment=Wiki+created+per+request+of+{{urlencode:Mattave}}&wpfounder={{urlencode:Mattave}}}} here]. Once the wiki has been created, [[Special:Userrights/Mattave@theracedirectorwiki|grant the local rights]]. (notify user: [{{fullurl:User talk:{{urlencode:Mattave}}|action=edit&section=new&preload=Template:Wiki_created}} done] · [{{fullurl:User talk:{{urlencode:Mattave}}|action=edit&section=new&preload=Wiki_not_created}} not done])</small>
 
{{Done}} [[User:Reception123|Reception123]] ([[User talk:Reception123|talk]]) 18:53, 10 July 2015 (BST)
 
== Instructors Guide <small>(Status: Done)</small> ==
* Wiki ID: AdultLearningwiki
* URL: AdultLearning.orain.org
* Type: Public
* File uploads: Yes
* Description: A reference tool for instructors of adult learners
* Default language: "en"
[[User:Thomas.dalton|Thomas.dalton]] ([[User talk:Thomas.dalton|talk]]) 06:34, 11 July 2015 (BST)
 
<small>'''Stewards and wiki creators''': To create the requested wiki, click [{{fullurl:Special:CreateWiki|Special:CreateWiki&wpdbname=AdultLearningwiki&wpcomment=Wiki+created+per+request+of+{{urlencode:Thomas.dalton}}&wpfounder={{urlencode:Thomas.dalton}}}} here]. Once the wiki has been created, [[Special:Userrights/Thomas.dalton@AdultLearningwiki|grant the local rights]]. (notify user: [{{fullurl:User talk:{{urlencode:Thomas.dalton}}|action=edit&section=new&preload=Template:Wiki_created}} done] · [{{fullurl:User talk:{{urlencode:Thomas.dalton}}|action=edit&section=new&preload=Wiki_not_created}} not done])</small>
 
{{Done}} [[User:Reception123|Reception123]] ([[User talk:Reception123|talk]]) 08:07, 11 July 2015 (BST)
 
== Hyperiums MMO Wikipedia <small>(Status: Done)</small> ==
* Wiki ID: Hyperiumswiki
* URL: Hyperiums.orain.org
* Type: public
* File uploads: yes
* Description: Hyperiums is an mmo rts created early 2001 based on planetary domination. Primarily a trade and battle based game, Hyperiums offers complex and deep gameplay on a data lite html platform.
* Description: It's supposed to be like a comprehensive database of all the hard to remember registers, instructions and memory adresses for programming in the world of 8 bit atmel avr microprocessors. www.atmel.com for more info.
* Default language: en
[[User:ErnosernosPotshot|ErnosernosPotshot]] ([[User talk:ErnosernosPotshot|talk]]) 0220:2728, 2511 OctoberJuly 20142015 (BST)
 
<small>'''Stewards and wiki creators''': To create the requested wiki, click [{{fullurl:Special:CreateWiki|Special:CreateWiki&wpdbname=atmega32.orain.orgwikiHyperiumswiki&wpcomment=Wiki+created+per+request+of+{{urlencode:ErnosernosPotshot}}&wpfounder={{urlencode:ErnosernosPotshot}}}} here]. Once the wiki has been created, [[Special:Userrights/ErnosernosPotshot@atmega32.orain.orgwikiHyperiumswiki|grant the local rights]]. (notify user: [{{fullurl:User talk:{{urlencode:Potshot}}|action=edit&section=new&preload=Template:Wiki_created}} done] · [{{fullurl:User talk:{{urlencode:Potshot}}|action=edit&section=new&preload=Wiki_not_created}} not done])</small>
 
:{{done}} - [[User:Southparkfan|Southparkfan]] ([[User talk:Southparkfan|talk]]) 20:50, 29 October 2014 (GMT)
{{Done}} [[User:Reception123|Reception123]] ([[User talk:Reception123|talk]]) 05:35, 12 July 2015 (BST)
== Sosyalizm deneyimleri <small>(Status: Done)</small> ==
 
* Wiki ID: sosyalizm-deneyimleriwiki
== Savitrimai ==
* URL: sosyalizm-deneyimleri.orain.org
 
* Type: Private
== Savitrimai Phule <small>(Status: Done)</small> ==
* Wiki ID: savitrimaiwiki
* URL: savitrimai.orain.org
* Type: Public
* File uploads: yes
* Description: Savitribai Phule Birth anniversary 3rd January as an Indian Teachers' Day
* Description: Workgroup for history and future of practices and projects of socialism, by the foundation of social researches based in Istanbul
* Default language: "tr"en
[[User:Hadi.kahramanAdityasir|Hadi.kahramanAdityasir]] ([[User talk:Hadi.kahramanAdityasir|talk]]) 1101:5443, 2612 OctoberJuly 20142015 (GMTBST)
 
<small>'''Stewards and wiki creators''': To create the requested wiki, click [{{fullurl:Special:CreateWiki|Special:CreateWiki&wpdbname=sosyalizm-deneyimleriwikisavitrimaiwiki&wpcomment=Wiki+created+per+request+of+{{urlencode:Hadi.kahramanAdityasir}}&wpfounder={{urlencode:Hadi.kahramanAdityasir}}}} here]. Once the wiki has been created, [[Special:Userrights/Hadi.kahramanAdityasir@sosyalizm-deneyimleriwikisavitrimaiwiki|grant the local rights]]. (notify user: [{{fullurl:User talk:{{urlencode:Adityasir}}|action=edit&section=new&preload=Template:Wiki_created}} done] · [{{fullurl:User talk:{{urlencode:Adityasir}}|action=edit&section=new&preload=Wiki_not_created}} not done])</small>
 
:{{done}} - sosyalizmden(...).orain.org [[User:Southparkfan|Southparkfan]] ([[User talk:Southparkfan|talk]]) 20:50, 29 October 2014 (GMT)
{{Done}} [[User:Reception123|Reception123]] ([[User talk:Reception123|talk]]) 05:35, 12 July 2015 (BST)
== ielatif wiki <small>(Status: Done)</small> ==
 
* Wiki ID: ielatifwiki
== Threefold Guilds <small>(Status: Done)</small> ==
* URL: ielatif.orain.org
* Wiki ID: threefoldguilds
* Type: Private
* URL: threefoldguilds
* Type: Public
* File uploads: yes
* Description: The Threefold Guilds wiki is an attempt to elucidate the necessary components and practices with which to create voluntary associations, guilds, which reaffirm and nourish the meta-family element of the human identity.
* Default language: "en"
[[User:Valleyclan|Valleyclan]] ([[User talk:Valleyclan|talk]]) 03:30, 12 July 2015 (BST)
 
<small>'''Stewards and wiki creators''': To create the requested wiki, click [{{fullurl:Special:CreateWiki|Special:CreateWiki&wpdbname=threefoldguilds (e.g. if you want gameofthrones.orain.org, write gameofthrones)wiki&wpcomment=Wiki+created+per+request+of+{{urlencode:Valleyclan}}&wpfounder={{urlencode:Valleyclan}}}} here]. Once the wiki has been created, [[Special:Userrights/Valleyclan@threefoldguilds (e.g. if you want gameofthrones.orain.org, write gameofthrones)wiki|grant the local rights]]. (notify user: [{{fullurl:User talk:{{urlencode:Valleyclan}}|action=edit&section=new&preload=Template:Wiki_created}} done] · [{{fullurl:User talk:{{urlencode:Valleyclan}}|action=edit&section=new&preload=Wiki_not_created}} not done])</small>
 
{{Done}} [[User:Reception123|Reception123]] ([[User talk:Reception123|talk]]) 05:35, 12 July 2015 (BST)
 
== Wikios ==
 
== Wikios <small>(Status: Done)</small> ==
* Wiki ID: wikioswiki
* URL: wikios.orain.org
* Type: public
* File uploads: yes
* Description: Wikios is about all topics. Wikios likes Wikipedia.
* Default language: nl
[[User:MHOG|MHOG]] ([[User talk:MHOG|talk]]) 15:37, 12 July 2015 (BST)
 
<small>'''Stewards and wiki creators''': To create the requested wiki, click [{{fullurl:Special:CreateWiki|Special:CreateWiki&wpdbname=wikioswiki&wpcomment=Wiki+created+per+request+of+{{urlencode:MHOG}}&wpfounder={{urlencode:MHOG}}}} here]. Once the wiki has been created, [[Special:Userrights/MHOG@wikioswiki|grant the local rights]]. (notify user: [{{fullurl:User talk:{{urlencode:MHOG}}|action=edit&section=new&preload=Template:Wiki_created}} done] · [{{fullurl:User talk:{{urlencode:MHOG}}|action=edit&section=new&preload=Wiki_not_created}} not done])</small>
 
{{Done}} [[User:Reception123|Reception123]] ([[User talk:Reception123|talk]]) 18:34, 12 July 2015 (BST)
 
== PocketAww <small>(Status: Done)</small> ==
* Wiki ID: pocketawwwiki
* URL: pocketaww.orain.org
* Type: Public
* File uploads: yes
* Description: The wiki about the open-source applications and games developing team, PocketAww!
* Default language: en
[[User:JeDa|JeDa]] ([[User talk:JeDa|talk]]) 22:35, 12 July 2015 (BST)
 
<small>'''Stewards and wiki creators''': To create the requested wiki, click [{{fullurl:Special:CreateWiki|Special:CreateWiki&wpdbname=pocketawwwiki&wpcomment=Wiki+created+per+request+of+{{urlencode:JeDa}}&wpfounder={{urlencode:JeDa}}}} here]. Once the wiki has been created, [[Special:Userrights/JeDa@pocketawwwiki|grant the local rights]]. (notify user: [{{fullurl:User talk:{{urlencode:JeDa}}|action=edit&section=new&preload=Template:Wiki_created}} done] · [{{fullurl:User talk:{{urlencode:JeDa}}|action=edit&section=new&preload=Wiki_not_created}} not done])</small>
 
{{Done}} [[User:Reception123|Reception123]] ([[User talk:Reception123|talk]]) 05:51, 13 July 2015 (BST)
:{{ping|JeDa}} in the future, please do not mess with this template after posting it. Your wiki ID '''must end in "wiki"''' the template is like this for a reason. -- Cheers, [[User:NDKilla|NDKilla]] <sup> ( [[User talk:NDKilla|Talk]] • [[Special:Contributions/NDKilla|Contribs]] ) </sup> 10:59, 13 July 2015 (BST)
 
== Urist McStation Wiki <small>(Status: Done)</small> ==
* Wiki ID: uristmcstationwiki
* URL: uristmcstation.orain.org
* Type: Public
* File uploads: Yes
* Description: A wiki for the Space Station 13 server Urist McStation. I'd like to set it up as an in-character informational wiki. (As a side note, I've had a few problems trying to set this request up; hopefully it works properly now.)
* Description: Education + tutorials
* Default language: fren
[[User:IelatifAlysiaKael|IelatifAlysiaKael]] ([[User talk:IelatifAlysiaKael|talk]]) 1907:3716, 2613 OctoberJuly 20142015 (GMTBST)
 
<small>'''Stewards and wiki creators''': To create the requested wiki, click [{{fullurl:Special:CreateWiki|Special:CreateWiki&wpdbname=ielatifwikiuristmcstationwiki&wpcomment=Wiki+created+per+request+of+{{urlencode:IelatifAlysiaKael}}&wpfounder={{urlencode:IelatifAlysiaKael}}}} here]. Once the wiki has been created, [[Special:Userrights/IelatifAlysiaKael@ielatifwikiuristmcstationwiki|grant the local rights]]. (notify user: [{{fullurl:User talk:{{urlencode:AlysiaKael}}|action=edit&section=new&preload=Template:Wiki_created}} done] · [{{fullurl:User talk:{{urlencode:AlysiaKael}}|action=edit&section=new&preload=Wiki_not_created}} not done])</small>
 
:{{done}} - [[User:Southparkfan|Southparkfan]] ([[User talk:Southparkfan|talk]]) 20:50, 29 October 2014 (GMT)
{{Done}} [[User:Reception123|Reception123]] ([[User talk:Reception123|talk]]) 07:30, 13 July 2015 (BST)
== Second Apocalypse <small>(Status: Done)</small> ==
 
* Wiki ID: sawiki
== Live Roleplaying: Skyrim <small>(Status: Done)</small> ==
* URL: sa.orain.org
* Wiki ID: LiveRoleplayingSkyrimwiki
* URL: LiveRoleplayingSkyrim.orain.org
* Type: Public
* File uploads: Yes
* Description: The official Live Roleplaying: Skyrim wiki! We are a group hosted on the TamrialVault.com that rolepalys in a DnD styled universe of the fifth game of the Elder Scrolls series.
* Default language: en
[[User:Tae-Rai|Tae-Rai]] ([[User talk:Tae-Rai|talk]]) 19:58, 13 July 2015 (BST)
 
<small>'''Stewards and wiki creators''': To create the requested wiki, click [{{fullurl:Special:CreateWiki|Special:CreateWiki&wpdbname=Live Roleplaying Skyrimwiki&wpcomment=Wiki+created+per+request+of+{{urlencode:Tae-Rai}}&wpfounder={{urlencode:Tae-Rai}}}} here]. Once the wiki has been created, [[Special:Userrights/Tae-Rai@Live Roleplaying Skyrimwiki|grant the local rights]]. (notify user: [{{fullurl:User talk:{{urlencode:Tae-Rai}}|action=edit&section=new&preload=Template:Wiki_created}} done] · [{{fullurl:User talk:{{urlencode:Tae-Rai}}|action=edit&section=new&preload=Wiki_not_created}} not done])</small>
 
{{Done}} [[User:Reception123|Reception123]] ([[User talk:Reception123|talk]]) 20:07, 13 July 2015 (BST)
 
== Linux Wiki <small>(Status: Done)</small> ==
* Wiki ID: <s>linux-unixwiki</s> linuxunixwiki
* URL: <s>linux-unix.orain.org</s> linuxunix.orain.org
* Type: Public
* File uploads: yes
* Description: Create a Wiki about Linux and related topics (like Unix). It will include installation tutorials for software on the different Linux distributions.
* Description: A Wiki about a series of SFF novels by R. Scott Bakker, the series is called ''The Second Apocalypse'' and consists of two other series called the ''Prince of Nothing'' and ''Aspect-Emperor''.
* Default language: en
[[User:Fuse809|<span style = "color:green">'''Brenton'''</span>]] ([[Special:Contributions/Fuse809|contribs]] · [[Special:EmailUser/Fuse809|email]] · [[User_talk:Fuse809|talk]] · [[Commons:Special:ListFiles/Fuse809|uploads]]) 02:55, 15 July 2015 (BST)
[[User:Sma|Sma]] ([[User talk:Sma|talk]]) 15:27, 28 October 2014 (GMT)
 
<small>'''Stewards and wiki creators''': To create the requested wiki, click [{{fullurl:Special:CreateWiki|Special:CreateWiki&wpdbname=linux-unixwiki&wpcomment=Wiki+created+per+request+of+{{urlencode:Fuse809}}&wpfounder={{urlencode:Fuse809}}}} here]. Once the wiki has been created, [[Special:Userrights/Fuse809@linux-unixwiki|grant the local rights]]. (notify user: [{{fullurl:User talk:{{urlencode:Fuse809}}|action=edit&section=new&preload=Template:Wiki_created}} done] · [{{fullurl:User talk:{{urlencode:Fuse809}}|action=edit&section=new&preload=Wiki_not_created}} not done])</small>
 
{{Done}} [[User:Reception123|Reception123]] ([[User talk:Reception123|talk]]) 05:37, 15 July 2015 (BST)
 
{{Note}} As I cannot include hypens your wiki ID is linuxunixwiki. [[User:Reception123|Reception123]] ([[User talk:Reception123|talk]]) 05:37, 15 July 2015 (BST)
 
== {{{title}}} <small>(Status: not done)</small> ==
* Wiki ID: {{{subdomain}}}wiki
* URL: {{{subdomain}}}.orain.org
* Type: {{{type}}}
* File uploads: Replace this with yes if you want file uploads to be enabled on your wiki
* Description: {{{description}}}
* Default language: en
[[User:YorkieBartram|YorkieBartram]] ([[User talk:YorkieBartram|talk]]) 17:48, 15 July 2015 (BST)
 
<small>'''Stewards and wiki creators''': To create the requested wiki, click [{{fullurl:Special:CreateWiki|Special:CreateWiki&wpdbname={{{subdomain}}}wiki&wpcomment=Wiki+created+per+request+of+{{urlencode:YorkieBartram}}&wpfounder={{urlencode:YorkieBartram}}}} here]. Once the wiki has been created, [[Special:Userrights/YorkieBartram@{{{subdomain}}}wiki|grant the local rights]]. (notify user: [{{fullurl:User talk:{{urlencode:YorkieBartram}}|action=edit&section=new&preload=Template:Wiki_created}} done] · [{{fullurl:User talk:{{urlencode:YorkieBartram}}|action=edit&section=new&preload=Wiki_not_created}} not done])</small>
 
{{Not done}} no info provided -- Cheers, [[User:NDKilla|NDKilla]] <sup> ( [[User talk:NDKilla|Talk]] • [[Special:Contributions/NDKilla|Contribs]] ) </sup> 19:45, 15 July 2015 (BST)
 
== Investement ==
 
== {{{title}}} <small>(Status: Not done)</small> ==
<small>'''Stewards and wiki creators''': To create the requested wiki, click [{{fullurl:Special:CreateWiki|Special:CreateWiki&wpdbname=sawiki&wpcomment=Wiki+created+per+request+of+{{urlencode:Sma}}&wpfounder={{urlencode:Sma}}}} here]. Once the wiki has been created, [[Special:Userrights/Sma@sawiki|grant the local rights]]. </small>
:{{done}} - [[User:Southparkfan|Southparkfan]] ([[User talk:Southparkfan|talk]]) 20:50, 29 October 2014 (GMT)
== {{{title}}} <small>(Status: More information requested)</small> ==
* Wiki ID: {{{subdomain}}}wiki
* URL: {{{subdomain}}}.orain.org
Line 108 ⟶ 269:
* Description: {{{description}}}
* Default language: en
[[User:VitrexTimothyoreilly|VitrexTimothyoreilly]] ([[User talk:VitrexTimothyoreilly|talk]]) 1819:2834, 2815 OctoberJuly 20142015 (GMTBST)
 
<small>'''Stewards and wiki creators''': To create the requested wiki, click [{{fullurl:Special:CreateWiki|Special:CreateWiki&wpdbname={{{subdomain}}}wiki&wpcomment=Wiki+created+per+request+of+{{urlencode:VitrexTimothyoreilly}}&wpfounder={{urlencode:VitrexTimothyoreilly}}}} here]. Once the wiki has been created, [[Special:Userrights/VitrexTimothyoreilly@{{{subdomain}}}wiki|grant the local rights]]. (notify user: [{{fullurl:User talk:{{urlencode:Timothyoreilly}}|action=edit&section=new&preload=Template:Wiki_created}} done] · [{{fullurl:User talk:{{urlencode:Timothyoreilly}}|action=edit&section=new&preload=Wiki_not_created}} not done])</small>
 
:Please{{Not givedone}} theno title,info subdomain,provided and-- description of your wiki.Cheers, [[User:WynterNDKilla|WynterNDKilla]] <sup> ( [[User talk:WynterNDKilla|talkTalk]] • [[Special:Contributions/NDKilla|Contribs]] ) 04</sup> 19:5847, 2915 OctoberJuly 20142015 (GMTBST)
 
== Investment ==
== caloriwiki <small>(Status: Done)</small> ==
 
* Wiki ID: caloriwiki
== Investment <small>(Status: Pending, problem)</small> ==
* URL: calori.orain.org
* Wiki ID: Ivestmentwiki
* URL: Investmentwiki.orain.org
* Type: private
* File uploads: yes
* Description: sharing best practice
* Default language: en
[[User:Timothyoreilly|Timothyoreilly]] ([[User talk:Timothyoreilly|talk]]) 20:05, 15 July 2015 (BST)
 
<small>'''Stewards and wiki creators''': To create the requested wiki, click [{{fullurl:Special:CreateWiki|Special:CreateWiki&wpdbname={{{subdomain}}}wiki&wpcomment=Wiki+created+per+request+of+{{urlencode:Timothyoreilly}}&wpfounder={{urlencode:Timothyoreilly}}}} here]. Once the wiki has been created, [[Special:Userrights/Timothyoreilly@{{{subdomain}}}wiki|grant the local rights]]. (notify user: [{{fullurl:User talk:{{urlencode:Timothyoreilly}}|action=edit&section=new&preload=Template:Wiki_created}} done] · [{{fullurl:User talk:{{urlencode:Timothyoreilly}}|action=edit&section=new&preload=Wiki_not_created}} not done])</small>
 
{{Ping|Timothyoreilly}} Your URL is the same as your wiki ID but withought the wiki and .orain.org . If you do not decide on one I can't complete your request. --[[User:Reception123|Reception123]] ([[User talk:Reception123|talk]]) 20:22, 15 July 2015 (BST)
 
{{Ping|Reception123}} Updated. {{unsigned|Timothyoreilly}}
:{{ping|Timothyoreilly}} your ID and URL still aren't the same. Do you want your wiki to be "investmentwiki" not ivestment? (Typo missing the n?). Also wiki id's and urls must be all lowercase alphanumeric only. -- Cheers, [[User:NDKilla|NDKilla]] <sup> ( [[User talk:NDKilla|Talk]] • [[Special:Contributions/NDKilla|Contribs]] ) </sup> 21:29, 15 July 2015 (BST)
 
== Powis Castle History <small>(Status: Pending)</small> ==
* Wiki ID: powiscastlehistorywiki
* URL: powiscastlehistory.orain.org
* Type: private
* File uploads: no
* Description: Initially, a resource to correlate the history of Powis Castle in Wales with wider history of Britain and the world.
* Default language: en
[[User:YorkieBartram|YorkieBartram]] ([[User talk:YorkieBartram|talk]]) 23:36, 15 July 2015 (BST)
 
<small>'''Stewards and wiki creators''': To create the requested wiki, click [{{fullurl:Special:CreateWiki|Special:CreateWiki&wpdbname={{{subdomain}}}wiki&wpcomment=Wiki+created+per+request+of+{{urlencode:YorkieBartram}}&wpfounder={{urlencode:YorkieBartram}}}} here]. Once the wiki has been created, [[Special:Userrights/YorkieBartram@{{{subdomain}}}wiki|grant the local rights]]. (notify user: [{{fullurl:User talk:{{urlencode:YorkieBartram}}|action=edit&section=new&preload=Template:Wiki_created}} done] · [{{fullurl:User talk:{{urlencode:YorkieBartram}}|action=edit&section=new&preload=Wiki_not_created}} not done])</small>
 
:{{Ping|YorkieBartram}} Please could you tell me what title you want? --[[User:Reception123|Reception123]] ([[User talk:Reception123|talk]]) 05:24, 16 July 2015 (BST)
 
I would like "Powis Castle History", please. {{unsigned|YorkieBartram}}
 
{{Done}} [[User:Reception123|Reception123]] ([[User talk:Reception123|talk]]) 05:09, 17 July 2015 (BST)
 
== Anthropocene.Org Wiki <small>(Status: Done)</small> ==
* Wiki ID: anthropocenewiki
* URL: anthropocene.orain.org
* Type: Public
* File uploads: yes
* Description: CaloriWiki is a wikination infor the North AtlanticAnthropocene Ocean.Community
* Default language: "en"
[[User:Anthropocene.org|Anthropocene.org]] ([[User talk:Anthropocene.org|talk]]) 18:19, 16 July 2015 (BST)
 
<small>'''Stewards and wiki creators''': To create the requested wiki, click [{{fullurl:Special:CreateWiki|Special:CreateWiki&wpdbname=anthropocenewiki&wpcomment=Wiki+created+per+request+of+{{urlencode:Anthropocene.org}}&wpfounder={{urlencode:Anthropocene.org}}}} here]. Once the wiki has been created, [[Special:Userrights/Anthropocene.org@anthropocenewiki|grant the local rights]]. (notify user: [{{fullurl:User talk:{{urlencode:Anthropocene.org}}|action=edit&section=new&preload=Template:Wiki_created}} done] · [{{fullurl:User talk:{{urlencode:Anthropocene.org}}|action=edit&section=new&preload=Wiki_not_created}} not done])</small>
 
{{Done}} [[User:Reception123|Reception123]] ([[User talk:Reception123|talk]]) 20:06, 16 July 2015 (BST)
 
== Hearthstone Decks Wiki <small>(Status: Done)</small> ==
* Wiki ID: herthstonedeckswikiwiki
* URL: herthstonedeckswiki.orain.org
* Type: Public
* File uploads: yes
* Description: Corecting informations about hearthstone.
* Default language: English
[[User:Caitc|Caitc]] ([[User talk:Caitc|talk]]) 01:42, 17 July 2015 (BST)
 
<small>'''Stewards and wiki creators''': To create the requested wiki, click [{{fullurl:Special:CreateWiki|Special:CreateWiki&wpdbname=herthstonedeckswikiwiki&wpcomment=Wiki+created+per+request+of+{{urlencode:Caitc}}&wpfounder={{urlencode:Caitc}}}} here]. Once the wiki has been created, [[Special:Userrights/Caitc@herthstonedeckswikiwiki|grant the local rights]]. (notify user: [{{fullurl:User talk:{{urlencode:Caitc}}|action=edit&section=new&preload=Template:Wiki_created}} done] · [{{fullurl:User talk:{{urlencode:Caitc}}|action=edit&section=new&preload=Wiki_not_created}} not done])</small>
 
{{Done}} [[User:Reception123|Reception123]] ([[User talk:Reception123|talk]]) 05:13, 17 July 2015 (BST)
:{{ping|Reception123}} {{ping|Caitc}} can you confirm that the wiki was created at herthstonewiki.orain.org and not hearthstonewiki.orain.org (first is missing the a). Is this intentional ? -- Cheers, [[User:NDKilla|NDKilla]] <sup> ( [[User talk:NDKilla|Talk]] • [[Special:Contributions/NDKilla|Contribs]] ) </sup> 08:49, 18 July 2015 (BST)
 
::Yes, I can confirm. That's the wiki ID and URL that was indicated. --[[User:Reception123|Reception123]] ([[User talk:Reception123|talk]]) 10:04, 18 July 2015 (BST)
 
== Farming Simulator <small>(Status: Done)</small> ==
* Wiki ID: farmingsimulatorwiki
* URL: farmingsimulator.orain.org
* Type: Public
* File uploads: Yes
* Description: Provide details about the video game "Farming Simulator", gameplay, strategies, techniques, guides, information about modifications ("mods"), etc. There is another on Wikia already, but Wikia is horrible - looking for a wiki with a nice, clean, vector "wikipedia" like interface, no plastered ads and flashy overkill proprietary stuff making the wiki content harder to read and manage.
* Default language: en
[[User:Tau CetiSlivicon|Tau CetiSlivicon]] ([[User talk:Tau CetiSlivicon|talk]]) 0121:1650, 2917 OctoberJuly 20142015 (GMTBST)
 
<small>'''Stewards and wiki creators''': To create the requested wiki, click [{{fullurl:Special:CreateWiki|Special:CreateWiki&wpdbname=caloriwikifarmingsimulatorwiki&wpcomment=Wiki+created+per+request+of+{{urlencode:Tau CetiSlivicon}}&wpfounder={{urlencode:Tau CetiSlivicon}}}} here]. Once the wiki has been created, [[Special:Userrights/Tau CetiSlivicon@caloriwikifarmingsimulatorwiki|grant the local rights]]. (notify user: [{{fullurl:User talk:{{urlencode:Slivicon}}|action=edit&section=new&preload=Template:Wiki_created}} done] · [{{fullurl:User talk:{{urlencode:Slivicon}}|action=edit&section=new&preload=Wiki_not_created}} not done])</small>
:{{Done}} --[[User:Stryn|Stryn]] ([[User talk:Stryn|talk]]) 21:00, 29 October 2014 (GMT)
 
{{Done}} [[User:Reception123|Reception123]] ([[User talk:Reception123|talk]]) 05:21, 18 July 2015 (BST)
== Encyclopedium <small>(Status: Done)</small> ==
 
* Wiki ID: wh40kwiki
== Fabled RP <small>(Status: Done)</small> ==
* URL: wh40k.orain.org
* Wiki ID: fabledrpwiki
* URL: fabledrp.orain.org
* Type: Public
* File uploads: Yes
* Description: Even though largely inactive, I've been discussing it on Skype and I want to import my old wiki from fabled-rp.wikia.com
* Description: This wiki will be a fork of Lexicanum, which is available under Creative Commons, previously GFDL and attribution advised. This will be the first wiki to be forked, the English 40k wiki. We are forking it for several reasons. The site has been running MediaWiki 1.18.0 since 2011. Even after being attacked through SQL injection by Russian hackers, the owner does not take security seriously. It seems the new server side owner does not either. After the ownership transfer, the new owners frakked the site skin and made it nearly unreadable. '''EDIT''' There's a whole host of legitimate reasons to fork the wiki. Sorry if that came off as whining.
**A dump is available here: https://archive.org/details/wiki-wh40klexicanumcom_mediawiki
* Default language: en
-- Cheers, [[User:NDKilla|NDKilla]] <sup> ( [[User talk:NDKilla|Talk]] • [[Special:Contributions/NDKilla|Contribs]] ) </sup> 12:04, 19 July 2015 (BST)
[[User:Lieutenant S. Reznov|Lieutenant S., Geschichtsmeister des Lexipedium]] ([[User talk:Lieutenant S. Reznov|talk]]) 15:26, 29 October 2014 (GMT)
 
<small>'''Stewards and wiki creators''': To create the requested wiki, click [{{fullurl:Special:CreateWiki|Special:CreateWiki&wpdbname=wh40kwikifabledrpwiki&wpcomment=Wiki+created+per+request+of+{{urlencode:Lieutenant S. ReznovNDKilla}}&wpfounder={{urlencode:Lieutenant S. ReznovNDKilla}}}} here]. Once the wiki has been created, [[Special:Userrights/Lieutenant S. ReznovNDKilla@wh40kwikifabledrpwiki|grant the local rights]]. (notify user: [{{fullurl:User talk:{{urlencode:NDKilla}}|action=edit&section=new&preload=Template:Wiki_created}} done] · [{{fullurl:User talk:{{urlencode:NDKilla}}|action=edit&section=new&preload=Wiki_not_created}} not done])</small>
 
{{ping|Reception123}} Hi. -- Cheers, [[User:NDKilla|NDKilla]] <sup> ( [[User talk:NDKilla|Talk]] • [[Special:Contributions/NDKilla|Contribs]] ) </sup> 12:05, 19 July 2015 (BST)
The owner sounds a lot like FastEddie, so add all of Arcane's reason for forking ATT. [[User:Lieutenant S. Reznov|Lieutenant S., Geschichtsmeister des Lexipedium]] ([[User talk:Lieutenant S. Reznov|talk]]) 17:20, 29 October 2014 (GMT)
:I checked the relicensing conditions, and since it's dual licensed under GDFL/Creative Commons, I would recommend getting a current revision dump if possible and importing that (same rule applied when we forked TVT) via a CC license. If you were to use the GDFL license, you would need a full history dump under GDFL rules. Also, some of the extensions used on that wiki are customized for that wiki or may be outdated, so you'll want to fork anything specific to Orain's repository you want to keep and are willing to keep current. There should be no legal reason for the owner to attempt preventing you from forking to Orain, but make sure you don't import any content that has specific reuse conditions not covered under GDFL/CC rules unless you have prior authorization. A full image dump under the same guidelines is also advised. [[User:GethN7|GethN7]] ([[User talk:GethN7|talk]]) 20:28, 29 October 2014 (GMT)
::It was never officially under the GFDL. BoLS released it under CC officially now. Before it was just "use attribution." I don't care about having any specific extensions from that site. [[User:Lieutenant S. Reznov|Lieutenant S., Geschichtsmeister des Lexipedium]] ([[User talk:Lieutenant S. Reznov|talk]]) 00:52, 30 October 2014 (GMT)
:::{{done}} - created. [[User:Southparkfan|Southparkfan]] ([[User talk:Southparkfan|talk]]) 15:14, 30 October 2014 (GMT)
 
{{Done}} [[User:Reception123|Reception123]] ([[User talk:Reception123|talk]]) 12:27, 19 July 2015 (BST)
== Wissensschnippsel <small>(Status: Done)</small> ==
 
* Wiki ID: howtowiki
== MCFontana <small>(Status: Done)</small> ==
* URL: howto.orain.org
* Wiki ID: mcfontanawiki
* Type: Private
* URL: mcfontana.orain.org
* Type: Public
* File uploads: yes
* Description: It's for my upcomming minecraft server. But because there are many things added like custom food. i want to make a wiki so people know what the need to do
* Description: Kleines Wissensmanagement
* Default language: denl
[[User:Joachim-happelMelerpe|Joachim-happelMelerpe]] ([[User talk:Joachim-happelMelerpe|talk]]) 0912:2127, 3019 OctoberJuly 20142015 (GMTBST)
 
<small>'''Stewards and wiki creators''': To create the requested wiki, click [{{fullurl:Special:CreateWiki|Special:CreateWiki&wpdbname=howtowikimcfontanawiki&wpcomment=Wiki+created+per+request+of+{{urlencode:Joachim-happelMelerpe}}&wpfounder={{urlencode:Joachim-happelMelerpe}}}} here]. Once the wiki has been created, [[Special:Userrights/Joachim-happelMelerpe@howtowikimcfontanawiki|grant the local rights]]. (notify user: [{{fullurl:User talk:{{urlencode:Melerpe}}|action=edit&section=new&preload=Template:Wiki_created}} done] · [{{fullurl:User talk:{{urlencode:Melerpe}}|action=edit&section=new&preload=Wiki_not_created}} not done])</small>
 
{{Done}} [[User:Reception123|Reception123]] ([[User talk:Reception123|talk]]) 16:35, 19 July 2015 (BST)
== EBTee <small>(Status: Pending)</small> ==
 
* Wiki ID: wiki
== Wikeography <small>(Status: Done)</small> ==
* URL: .orain.org
* Wiki ID: wikeography
* URL: wikeography.orain.org
* Type: Public
* File uploads: yes
* Description: This is a wiki about geography. It's a sort of travel guide. But it displays some information like history too.
* Default language: en
[[User:PieterReg|PieterReg]] ([[User talk:PieterReg|talk]]) 16:11, 20 July 2015 (BST)
 
<small>'''Stewards and wiki creators''': To create the requested wiki, click [{{fullurl:Special:CreateWiki|Special:CreateWiki&wpdbname=wikeographywiki&wpcomment=Wiki+created+per+request+of+{{urlencode:PieterReg}}&wpfounder={{urlencode:PieterReg}}}} here]. Once the wiki has been created, [[Special:Userrights/PieterReg@wikeographywiki|grant the local rights]]. (notify user: [{{fullurl:User talk:{{urlencode:PieterReg}}|action=edit&section=new&preload=Template:Wiki_created}} done] · [{{fullurl:User talk:{{urlencode:PieterReg}}|action=edit&section=new&preload=Wiki_not_created}} not done])</small>
 
{{Done}} [[User:Reception123|Reception123]] ([[User talk:Reception123|talk]]) 16:24, 20 July 2015 (BST)
 
== Fungopedia <small>(Status: Done)</small> ==
* Wiki ID: fungopediawiki
* URL: fungopedia.orain.org
* Type: Private
* File uploads: yes
* Description: Fill it with a plethora of information on a conworld my friends and I are creating.
* Description: EBTee Wiki zur Vorbereitung auf die Prüfungen!
* Default language: en
* Default language: Replace this with the ISO 639-1 code of the default language for your wiki. If you want to use English, fill in "en"
[[User:DADGADXylophonw|DADGADXylophonw]] ([[User talk:DADGADXylophonw|talk]]) 2209:4500, 3021 OctoberJuly 20142015 (GMTBST)
 
<small>'''Stewards and wiki creators''': To create the requested wiki, click [{{fullurl:Special:CreateWiki|Special:CreateWiki&wpdbname=wikifungopediawiki&wpcomment=Wiki+created+per+request+of+{{urlencode:DADGADXylophonw}}&wpfounder={{urlencode:DADGADXylophonw}}}} here]. Once the wiki has been created, [[Special:Userrights/DADGADXylophonw@wikifungopediawiki|grant the local rights]]. (notify user: [{{fullurl:User talk:{{urlencode:Xylophonw}}|action=edit&section=new&preload=Template:Wiki_created}} done] · [{{fullurl:User talk:{{urlencode:Xylophonw}}|action=edit&section=new&preload=Wiki_not_created}} not done])</small>
 
:Request is fine. Should be done soon. --[[User:Reception123|Reception123]] ([[User talk:Reception123|talk]]) 09:17, 21 July 2015 (BST)
== Portals for developing <small>(Status: Done)</small> ==
{{Done}} by NDKilla. [[User:Reception123|Reception123]] ([[User talk:Reception123|talk]]) 14:39, 24 July 2015 (BST)
* Wiki ID: Portalsdevelopingwiki
 
* URL: Portalsdeveloping.orain.org
== Ondru Systems Manual <small>(Status: Done)</small> ==
* Wiki ID: ondruwiki
* URL: ondru.orain.org
* Type: Private
* File uploads: Yes
* Description: This wiki is a platform to host operational information, and encourage collaboration among stakeholders, for an arts-based not-for-profit.
* Default language: en
[[User:Ondru.systems|Ondru.systems]] ([[User talk:Ondru.systems|talk]]) 01:35, 22 July 2015 (BST)
 
<small>'''Stewards and wiki creators''': To create the requested wiki, click [{{fullurl:Special:CreateWiki|Special:CreateWiki&wpdbname=ondruwiki&wpcomment=Wiki+created+per+request+of+{{urlencode:Ondru.systems}}&wpfounder={{urlencode:Ondru.systems}}}} here]. Once the wiki has been created, [[Special:Userrights/Ondru.systems@ondruwiki|grant the local rights]]. (notify user: [{{fullurl:User talk:{{urlencode:Ondru.systems}}|action=edit&section=new&preload=Template:Wiki_created}} done] · [{{fullurl:User talk:{{urlencode:Ondru.systems}}|action=edit&section=new&preload=Wiki_not_created}} not done])</small>
 
:Request is fine. Should be done soon. --[[User:Reception123|Reception123]] ([[User talk:Reception123|talk]]) 05:25, 22 July 2015 (BST)
 
{{Done}} by [[User:NDKilla|NDKilla]]. [[User:Reception123|Reception123]] ([[User talk:Reception123|talk]]) 14:41, 24 July 2015 (BST)
== wikijici <small>(Status: Done)</small> ==
* Wiki ID: jicigagnonwiki
* URL: jicigagnon.orain.org
* Type: Public
* File uploads: yes
* Description: Encyclopédie informelle et surtout éclectique.
* Description: Group for developing programs together (programming language processing / JAVA / C++ et.al.)
* Default language: enfr
[[User:LahanaJicigagnon|LahanaJicigagnon]] ([[User talk:LahanaJicigagnon|talk]]) 2213:4530, 222 NovemberJuly 20142015 (GMTBST)
 
<small>'''Stewards and wiki creators''': To create the requested wiki, click [{{fullurl:Special:CreateWiki|Special:CreateWiki&wpdbname=jicigagnonwiki&wpcomment=Wiki+created+per+request+of+{{urlencode:Jicigagnon}}&wpfounder={{urlencode:Jicigagnon}}}} here]. Once the wiki has been created, [[Special:Userrights/Jicigagnon@jicigagnonwiki|grant the local rights]]. (notify user: [{{fullurl:User talk:{{urlencode:Jicigagnon}}|action=edit&section=new&preload=Template:Wiki_created}} done] · [{{fullurl:User talk:{{urlencode:Jicigagnon}}|action=edit&section=new&preload=Wiki_not_created}} not done])</small>
 
Looks good. Should be done. (Ca parait bien, ca cerait fait) --[[User:Reception123|Reception123]] ([[User talk:Reception123|talk]]) 14:15, 22 July 2015 (BST)
 
{{Done}} by [[User:NDKilla|NDKilla]]. [[User:Reception123|Reception123]] ([[User talk:Reception123|talk]]) 14:41, 24 July 2015 (BST)
 
== Particle <small>(Status: Done)</small> ==
<small>'''Stewards and wiki creators''': To create the requested wiki, click [{{fullurl:Special:CreateWiki|Special:CreateWiki&wpdbname=Portalsdevelopingwiki&wpcomment=Wiki+created+per+request+of+{{urlencode:Lahana}}&wpfounder={{urlencode:Lahana}}}} here]. Once the wiki has been created, [[Special:Userrights/Lahana@Portalsdevelopingwiki|grant the local rights]]. </small>
* Wiki ID: particlewiki
:{{done}} - [[User:Southparkfan|Southparkfan]] ([[User talk:Southparkfan|talk]]) 10:41, 8 November 2014 (GMT)
* URL: particle.orain.org
== ChemTalk <small>(Status: Partial done)</small> ==
* Wiki ID: ChemTalk
* URL: chemtalk.org has been pointed to orain nameservers
* Type: Public
* File uploads: YesNo
* Description: AThe collectionpurpose of chemistrythis tips,wiki tricks,is andto reactionshare setupsknowledge forabout studentthe researchersParticle platform
* Default language: en
[[User:BazaamJorisdgff|BazaamJorisdgff]] ([[User talk:BazaamJorisdgff|talk]]) 2210:0556, 323 NovemberJuly 20142015 (GMTBST)
 
<small>'''Stewards and wiki creators''': To create the requested wiki, click [{{fullurl:Special:CreateWiki|Special:CreateWiki&wpdbname={{{subdomain}}}wikiparticlewiki&wpcomment=Wiki+created+per+request+of+{{urlencode:BazaamJorisdgff}}&wpfounder={{urlencode:BazaamJorisdgff}}}} here]. Once the wiki has been created, [[Special:Userrights/BazaamJorisdgff@{{{subdomain}}}wikiparticlewiki|grant the local rights]]. (notify user: [{{fullurl:User talk:{{urlencode:Jorisdgff}}|action=edit&section=new&preload=Template:Wiki_created}} done] · [{{fullurl:User talk:{{urlencode:Jorisdgff}}|action=edit&section=new&preload=Wiki_not_created}} not done])</small>
:{{done}} - awaiting the correct dns/nginx/mediawikiLooks settingsgood. YouShould canbe startdone working on chemtalk.orain.org until the domain settings are changedsoon. --[[User:SouthparkfanReception123|SouthparkfanReception123]] ([[User talk:SouthparkfanReception123|talk]]) 1011:4132, 823 NovemberJuly 20142015 (GMTBST)
::Orain's nameservers are ns1.orain.org and ns2.orain.org - the domain doesn't point to them. [[User:Southparkfan|Southparkfan]] ([[User talk:Southparkfan|talk]]) 10:44, 8 November 2014 (GMT)
 
{{Done}} by [[User:NDKilla|NDKilla]]. [[User:Reception123|Reception123]] ([[User talk:Reception123|talk]]) 14:41, 24 July 2015 (BST)
== LincolNonfiction <small>(Status: Done)</small> ==
== UWE Econonomics <small>(Status: Done)</small> ==
* Wiki ID: lincolnonfictionwiki
* Wiki ID: econuwewiki
* URL: lincolnonfiction.orain.org
* URL: econuwe.orain.org
* Type: Public, but please don't place this in the list of wikis and please delete this request 5 days after it is decided.
* Type: Public
* File uploads: Yes, but tell me how
* File uploads: yes
* Description: A nonfiction wiki for... Lincoln elementary ICCSD students
* Description: Hi - this Wiki is for an academic economics department at UWE, Bristol, UK to collect useful links, forms, procedures and so on. Many thanks.
* Default language: en
[[User:The BOLT!Jomichell|The BOLT!Jomichell]] ([[User talk:The BOLT!Jomichell|talk]]) 0114:2831, 423 NovemberJuly 20142015 (GMTBST)
 
<small>'''Stewards and wiki creators''': To create the requested wiki, click [{{fullurl:Special:CreateWiki|Special:CreateWiki&wpdbname=lincolnonfictionwikiuwe-econwiki&wpcomment=Wiki+created+per+request+of+{{urlencode:The BOLT!Jomichell}}&wpfounder={{urlencode:The BOLT!Jomichell}}}} here]. Once the wiki has been created, [[Special:Userrights/The BOLT!Jomichell@lincolnonfictionwikiuwe-econwiki|grant the local rights]]. (notify user: [{{fullurl:User talk:{{urlencode:Jomichell}}|action=edit&section=new&preload=Template:Wiki_created}} done] · [{{fullurl:User talk:{{urlencode:Jomichell}}|action=edit&section=new&preload=Wiki_not_created}} not done])</small>
:{{done}} - we can't remove this from the list of wikis. I guess you still want a private wiki, let me know if you want the wiki made private. [[User:Southparkfan|Southparkfan]] ([[User talk:Southparkfan|talk]]) 10:41, 8 November 2014 (GMT)
::Please sysop and crat me on the wiki. I do not have those rights. [[User:The BOLT!|The BOLT!]] ([[User talk:The BOLT!|talk]]) 20:36, 9 November 2014 (GMT)
 
{{Ping|Jomichell}} The wiki-id and URL cannot contain dashes (-). --[[User:Reception123|Reception123]] ([[User talk:Reception123|talk]]) 18:12, 23 July 2015 (BST)
== MKL3 Workshop D3 <small>(Status: Done)</small> ==
 
* Wiki ID: mkl3workshopd3wiki
{{Ping|Reception123}} OK, sorry about that. Have a suggested an alternative. Thanks. (-). --[[User:Jomichell|Jomichell]]
* URL: mkl3workshopd3.orain.org
 
* Type: Private
{{Done}} by [[User:NDKilla|NDKilla]]. [[User:Reception123|Reception123]] ([[User talk:Reception123|talk]]) 14:41, 24 July 2015 (BST)
== CoC Revamp Mod <small>(Status: Done)</small> ==
* Wiki ID: CoCRevampModwiki
* URL: CoCRevampMod.orain.org
* Type: This is for Corruption of Champions v0.9.4C Revamp Mod by Kitteh6660. We are expanding the size and scope of the original CoC who was developed by Fenoxo.
* File uploads: yes
* Description: This is primarily for the history of Mereth in original CoC upto the point where Revamp began, then the history from that point on as Revamp sees it. The various races through modified CoC, which includes all races in original CoC plus what we have developed and are developing now. Racial TFs, quests, NPCs, templates, etc. All that has happened within CoC and CoC Revamp. You see this grow over time.
* Description: dokumentieren von Projekt
* Default language: deen
[[User:Angel GergovRycharde|Angel GergovRycharde]] ([[User talk:Angel GergovRycharde|talk]]) 0905:5226, 524 NovemberJuly 20142015 (GMTBST)
 
<small>'''Stewards and wiki creators''': To create the requested wiki, click [{{fullurl:Special:CreateWiki|Special:CreateWiki&wpdbname=mkl3workshopd3wikiCoCRevampModwiki&wpcomment=Wiki+created+per+request+of+{{urlencode:Angel GergovRycharde}}&wpfounder={{urlencode:Angel GergovRycharde}}}} here]. Once the wiki has been created, [[Special:Userrights/Angel GergovRycharde@mkl3workshopd3wikiCoCRevampModwiki|grant the local rights]]. (notify user: [{{fullurl:User talk:{{urlencode:Rycharde}}|action=edit&section=new&preload=Template:Wiki_created}} done] · [{{fullurl:User talk:{{urlencode:Rycharde}}|action=edit&section=new&preload=Wiki_not_created}} not done])</small>
 
:{{done}} - [[User:Southparkfan|Southparkfan]] ([[User talk:Southparkfan|talk]]) 10:41, 8 November 2014 (GMT)
:Looks good. Should be done soon. --[[User:Reception123|Reception123]] ([[User talk:Reception123|talk]]) 06:18, 24 July 2015 (BST)
== HST-FIGS wiki <small>(Status: Done)</small> ==
 
* Wiki ID: hstfigswiki
{{Done}} by [[User:NDKilla|NDKilla]]. [[User:Reception123|Reception123]] ([[User talk:Reception123|talk]]) 14:41, 24 July 2015 (BST)
* URL: hstfigs.orain.org
 
* Type: Private
== Check <small>(Status: Database Created, Domain Not Done)</small> ==
* Wiki ID: checkwiki
* URL: check.orain.org
* Type: Public
* File uploads: yes
* Description: This wiki will allow users to create people, country or institution pages (strictly limited to creating pages of people who work in government, international organisation, embassy or NGO). No libel is allowed and the users are solely responsible for all the comments (content) they write on pages. No porn, torrent, crime pics etc. are allowed. This is solely based on opening up officials and have them to be more transparent and ethical.
* Description: This wiki will be a communication site for our science project, which is a team of about 25 scientists working on a Hubble Space Telescope project to obtain spectra of distant galaxies. We will use the page to organize plans for our data analysis and publication.
* Default language: en
[[User:RhoadsCheck|RhoadsCheck]] ([[User talk:RhoadsCheck|talk]]) 0415:2420, 725 NovemberJuly 20142015 (GMTBST)
 
<small>'''Stewards and wiki creators''': To create the requested wiki, click [{{fullurl:Special:CreateWiki|Special:CreateWiki&wpdbname=hstfigswikicheckwiki&wpcomment=Wiki+created+per+request+of+{{urlencode:RhoadsCheck}}&wpfounder={{urlencode:RhoadsCheck}}}} here]. Once the wiki has been created, [[Special:Userrights/RhoadsCheck@hstfigswikicheckwiki|grant the local rights]]. (notify user: [{{fullurl:User talk:{{urlencode:Check}}|action=edit&section=new&preload=Template:Wiki_created}} done] · [{{fullurl:User talk:{{urlencode:Check}}|action=edit&section=new&preload=Wiki_not_created}} not done])</small>
:{{confirmed|Done}} <font face="MV Boli">[[User:Dusti|'''<font color="#ff0000">D</font><font color="#ff6600">u</font><font color="#009900">s</font><font color="#0000ff">t</font><font color="#6600cc">i</font>''']][[User talk:Dusti|<sup>*Let's talk!*</sup>]]</font> 15:30, 25 July 2015 (BST)
:{{done}} - [[User:Southparkfan|Southparkfan]] ([[User talk:Southparkfan|talk]]) 10:41, 8 November 2014 (GMT)
 
:Hi Dusti, the url doesn't work for me. Do I need to do anything to start editing it? [[User:Check|Check]] ([[User talk:Check|talk]])
== Learning Notes <small>(Status: Done)</small> ==
::Hi Check! Dusti has created the database for your wiki, but we are awaiting a system administrator to create the domain. Usually, this is done automatically, but it has to be done manually temporarily. This should get taken care of very shortly for you! I sincerely apologize and thank you for your cooperation. -- <font color="blue"><b>[[User:Joe G|Joe&nbsp;G.]]</b></font> ([[User_talk:Joe G|Talk]]) 23:54, 26 July 2015 (BST)
* Wiki ID: yatinlearnwiki
 
* URL: yatinlearn.orain.org
{{Ping|Joe G}} - Hi Joe, I think the domain is created. When I type the URL, it opens. If everything is done, can I get administrative permissions please? [[User:Check|Check]] ([[User talk:Check|talk]])
 
== Rainbow Umbrella <small>(Status: Done)</small> ==
* Wiki ID: rainbowumbrellawiki
* URL: rainbowumbrella.orain.org
* Type: Private
* File uploads: yes
* Description: This wikithis is fora keepingwiki notes offor thingsmy thatcompany. Iit havewill learnedbe relatedused tointernally theby Java/softwareabout development200 fieldfolks.
* Default language: en_GBen
[[User:Yatin9Scarse|Yatin9Scarse]] ([[User talk:Yatin9Scarse|talk]]) 1023:4939, 1026 NovemberJuly 20142015 (GMTBST)
 
<small>'''Stewards and wiki creators''': To create the requested wiki, click [{{fullurl:Special:CreateWiki|Special:CreateWiki&wpdbname=yatinlearnwikirainbowumbrellawiki&wpcomment=Wiki+created+per+request+of+{{urlencode:Yatin9Scarse}}&wpfounder={{urlencode:Yatin9Scarse}}}} here]. Once the wiki has been created, [[Special:Userrights/Yatin9Scarse@yatinlearnwikirainbowumbrellawiki|grant the local rights]]. (notify user: [{{fullurl:User talk:{{urlencode:Scarse}}|action=edit&section=new&preload=Template:Wiki_created}} done] · [{{fullurl:User talk:{{urlencode:Scarse}}|action=edit&section=new&preload=Wiki_not_created}} not done])</small>
:Hi Scarse! I've created the database for your wiki, but I need a system administrator to create the domain. This should be done shortly. Thank you for your patience! -- <font color="blue"><b>[[User:Joe G|Joe&nbsp;G.]]</b></font> ([[User_talk:Joe G|Talk]]) 23:52, 26 July 2015 (BST)
:{{Done}}. --[[User:Stryn|Stryn]] ([[User talk:Stryn|talk]]) 20:25, 13 November 2014 (GMT)
::Awesome! I'll keep checking back. thanks {{unsigned|Scarse}}
:{{done|Database Created}} and {{comment|Domain Creation Pending}}. {{Ping|Scarse}} Once the domain is created, I will need you to login to your wiki (you will still see a message about not having permission to view pages). Once you do this, please let me know and I will take care of granting you the appropriate permissions so you can view and administer your wiki. -- <font color="blue"><b>[[User:Joe G|Joe&nbsp;G.]]</b></font> ([[User_talk:Joe G|Talk]]) 23:56, 26 July 2015 (BST)
:I'm not sure how to login to my wiki. where can i find instructions for this? {{unsigned|Scarse}}
::Once the domain is created, you will navigate to [https://rainbowumbrella.orain.org/wiki/Special:UserLogin https://rainbowumbrella.orain.org/wiki/Special:UserLogin] and type the username and password you have already chosen to use here. Once you do this, you will likely still see a message that says you cannot view pages on that particular wiki. This is entirely okay. Leave a note here once you have done that and I will take care of the rest. ''You will not be able to use the above link until your domain is created.'' I will let you know when the domain creation is taken care of. I hope this answers your question. If not, please let me know! -- <font color="blue"><b>[[User:Joe G|Joe&nbsp;G.]]</b></font> ([[User_talk:Joe G|Talk]]) 00:13, 27 July 2015 (BST)
{{Ping|Scarse}} {{Done|Domain created}} - Sorry about the wait! Please login to your wiki and then post back here so I can grant you administrative permissions. -- <font color="blue"><b>[[User:Joe G|Joe&nbsp;G.]]</b></font> ([[User_talk:Joe G|Talk]]) 02:05, 5 August 2015 (BST)
 
== سیستمهای قدرت한국동요위키 <small>(Status: DonePending)</small> ==
* Wiki ID: Powersystemswikikoreadongyowiki
* URL: PowerSystemskoreadongyo.orain.org
* Type: PrivatePublic
* File uploads: noYes
* Description: Archiving informations(history) of the Korean Children's Song in Korea.
* Description: About power systems enggineering
* Default language: fako
[[User:MRH밤톨이친구|MRH밤톨이친구]] ([[User talk:MRH밤톨이친구|talk]]) 08:0255, 1228 NovemberJuly 20142015 (GMTBST)
 
<span class="plainlinks"><small>'''Stewards and wiki creators''': To create the requested wiki, click [{{fullurl:Special:CreateWiki|Special:CreateWiki&wpdbname=Powersystemswikikoreadongyowiki&wpcomment=Wiki+created+per+request+of+{{urlencode:MRH밤톨이친구}}&wpfounder={{urlencode:MRH밤톨이친구}}}} here]. Once the wiki has been created, [[Special:Userrights/MRH밤톨이친구@Powersystemswikikoreadongyowiki|grant the local rights]]. (notify user: [{{fullurl:User talk:{{urlencode:밤톨이친구}}|action=edit&section=new&preload=Template:Wiki_created}} done] · [{{fullurl:User talk:{{urlencode:밤톨이친구}}|action=edit&section=new&preload=Wiki_not_created}} not done])</small></span>
:{{Done}}. --[[User:Stryn밤톨이친구|Stryn밤톨이친구]] ([[User talk:Stryn밤톨이친구|talk]]) 2008:2555, 1328 NovemberJuly 20142015 (GMTBST)
 
== {{{title}}}Killerbunnies <small>(Status: Pending)</small> ==
* Wiki ID: kbunnieswiki
* Wiki ID: Replace this with the subdomain you want (e.g. if you want gameofthrones.orain.org, write gameofthrones)wiki
* URL: kbunnies.orain.org
* URL: Replace this with the subdomain you want (e.g. if you want gameofthrones.orain.org, write gameofthrones).orain.org
* Type: {{{type}}}Public
* File uploads: {{{fileuploads}}}Yes
* Description: {{{description}}}Just a little personal wiki I made. Nothing special
* Default language: en
[[User:KhanhndkAmoridere|KhanhndkAmoridere]] ([[User talk:KhanhndkAmoridere|talk]]) 1618:3344, 1228 NovemberJuly 20142015 (GMTBST)
 
<span class="plainlinks"><small>'''Stewards and wiki creators''': To create the requested wiki, click [{{fullurl:Special:CreateWiki|Special:CreateWiki&wpdbname=Replace this with the subdomain you want (e.g. if you want gameofthrones.orain.org, write gameofthrones)wikikbunnieswiki&wpcomment=Wiki+created+per+request+of+{{urlencode:KhanhndkAmoridere}}&wpfounder={{urlencode:KhanhndkAmoridere}}}} here]. Once the wiki has been created, [[Special:Userrights/KhanhndkAmoridere@Replace this withkbunnieswiki|grant the subdomainlocal you wantrights]]. (e.g.notify ifuser: you[{{fullurl:User wanttalk:{{urlencode:Amoridere}}|action=edit&section=new&preload=Template:Wiki_created}} gameofthrones.orain.org,done] write· gameofthrones)wiki[{{fullurl:User talk:{{urlencode:Amoridere}}|grantaction=edit&section=new&preload=Wiki_not_created}} thenot local rightsdone]]. )</small></span>
 
== VaniEthos Cataloger Wiki <small>(Status: Pending)</small> ==
* Wiki ID: vani.vanisource.orgwikiethoscatalogerwiki
* URL: vani.vanisource.orgethos-cataloger.orain.org
* Type: Public
* File uploads: yes
* Description: User documentation for Ethos Cataloger, a music cataloging software https://trello.com/b/ZAzRjbXZ/ethos-cataloger
* Description: Setup a wiki with translation
* Default language: en
[[User:ArnabZeugma|ArnabZeugma]] ([[User talk:ArnabZeugma|talk]]) 1721:1835, 1228 NovemberJuly 20142015 (GMTBST)
 
<span class="plainlinks"><small>'''Stewards and wiki creators''': To create the requested wiki, click [{{fullurl:Special:CreateWiki|&wpdbname=ethoscatalogerwiki&wpcomment=Wiki+created+per+request+of+{{urlencode:Zeugma}}&wpfounder={{urlencode:Zeugma}}}} here]. Once the wiki has been created, [[Special:Userrights/Zeugma@ethoscatalogerwiki|grant the local rights]]. (notify user: [{{fullurl:User talk:{{urlencode:Zeugma}}|action=edit&section=new&preload=Template:Wiki_created}} done] · [{{fullurl:User talk:{{urlencode:Zeugma}}|action=edit&section=new&preload=Wiki_not_created}} not done])</small></span>
 
== 한국영화위키 <small>(Status: Pending)</small> ==
* Wiki ID: koreafilmwiki
* URL: koreafilm.orain.org
* Type: Public
* File uploads: Yes
* Description: Archiving informations(history) of the Korean Movie.
* Default language: ko
[[User:밤톨이친구|밤톨이친구]] ([[User talk:밤톨이친구|talk]]) 07:24, 29 July 2015 (BST)
 
<span class="plainlinks"><small>'''Stewards and wiki creators''': To create the requested wiki, click [{{fullurl:Special:CreateWiki|Special:CreateWiki&wpdbname=vani.vanisource.orgwikikoreafilmwiki&wpcomment=Wiki+created+per+request+of+{{urlencode:Arnab밤톨이친구}}&wpfounder={{urlencode:Arnab밤톨이친구}}}} here]. Once the wiki has been created, [[Special:Userrights/Arnab밤톨이친구@vani.vanisource.orgwikikoreafilmwiki|grant the local rights]]. (notify user: [{{fullurl:User talk:{{urlencode:밤톨이친구}}|action=edit&section=new&preload=Template:Wiki_created}} done] · [{{fullurl:User talk:{{urlencode:밤톨이친구}}|action=edit&section=new&preload=Wiki_not_created}} not done])</small></span>
 
== Wiki Prueba JIPFBMWiki <small>(Status: Pending)</small> ==
* Wiki ID: wpjipwikiFBMwiki
* URL: wpjipfbmwiki.orain.org
* Type: Private
* File uploads: Yes
* Description: Private staff training
* Default language: en
[[User:Chrisfbm|Chrisfbm]] ([[User talk:Chrisfbm|talk]]) 17:43, 31 July 2015 (BST)
 
<span class="plainlinks"><small>'''Stewards and wiki creators''': To create the requested wiki, click [{{fullurl:Special:CreateWiki|&wpdbname={{{subdomain}}}wiki&wpcomment=Wiki+created+per+request+of+{{urlencode:Chrisfbm}}&wpfounder={{urlencode:Chrisfbm}}}} here]. Once the wiki has been created, [[Special:Userrights/Chrisfbm@{{{subdomain}}}wiki|grant the local rights]]. (notify user: [{{fullurl:User talk:{{urlencode:Chrisfbm}}|action=edit&section=new&preload=Template:Wiki_created}} done] · [{{fullurl:User talk:{{urlencode:Chrisfbm}}|action=edit&section=new&preload=Wiki_not_created}} not done])</small></span>
 
== SHEEHAN band <small>(Status: Pending)</small> ==
* Wiki ID: sheehanwiki
* URL: sheehan.orain.org
* Type: public
* File uploads: yes
* Description: Wikipage deabout pruebathe parasheehan aprenderband
* Default language: esen
[[User:JiprietoSHEEHAN-Fan|JiprietoSHEEHAN-Fan]] ([[User talk:JiprietoSHEEHAN-Fan|talk]]) 1812:1944, 121 NovemberAugust 20142015 (GMTBST)
 
<span class="plainlinks"><small>'''Stewards and wiki creators''': To create the requested wiki, click [{{fullurl:Special:CreateWiki|Special:CreateWiki&wpdbname=wpjipwikisheehanwiki&wpcomment=Wiki+created+per+request+of+{{urlencode:JiprietoSHEEHAN-Fan}}&wpfounder={{urlencode:JiprietoSHEEHAN-Fan}}}} here]. Once the wiki has been created, [[Special:Userrights/JiprietoSHEEHAN-Fan@wpjipwikisheehanwiki|grant the local rights]]. (notify user: [{{fullurl:User talk:{{urlencode:SHEEHAN-Fan}}|action=edit&section=new&preload=Template:Wiki_created}} done] · [{{fullurl:User talk:{{urlencode:SHEEHAN-Fan}}|action=edit&section=new&preload=Wiki_not_created}} not done])</small></span>
 
== MicrofabricationSecond Life Avatars <small>(Status: Pending)</small> ==
* Wiki ID: iqtwikisecondlifeavatarswiki
* URL: iqtsecondlifeavatars.orain.org
* Type: Public
* File uploads: Yes
* Description: For the use of archiving information/reviewing/history/location&prices of 'Second Life' (a virtual world environment) Avatars. A great amount of avatars are created in this virtual environment, where there is demand to have an idea of the product. There is also a demand for the archiving of such information as often, products come with expansive background and information, or where a product is no longer existent and the history of such products are of interest. With it being Second Life, I expect adult themes or casual nudity to crop up. I worry that the unusual bias of other wiki's might run afoul with someone who was merely showing a skin template. I intend to have a 18 or older warning as a main page prompt.
* Default language: en
[[User:MisterMetal|MisterMetal]] ([[User talk:MisterMetal|talk]]) 07:59, 2 August 2015 (BST)
 
<span class="plainlinks"><small>'''Stewards and wiki creators''': To create the requested wiki, click [{{fullurl:Special:CreateWiki|&wpdbname=secondlifeavatarswiki&wpcomment=Wiki+created+per+request+of+{{urlencode:MisterMetal}}&wpfounder={{urlencode:MisterMetal}}}} here]. Once the wiki has been created, [[Special:Userrights/MisterMetal@secondlifeavatarswiki|grant the local rights]]. (notify user: [{{fullurl:User talk:{{urlencode:MisterMetal}}|action=edit&section=new&preload=Template:Wiki_created}} done] · [{{fullurl:User talk:{{urlencode:MisterMetal}}|action=edit&section=new&preload=Wiki_not_created}} not done])</small></span>
 
== Ashenmyth <small>(Status: Pending)</small> ==
* Wiki ID: Ashenmythwiki
* URL: Ashenmyth.orain.org
* Type: Private
* File uploads: YESNo
* Description: Ashenmyth is a world building project started on LegendFire.com. It's the brain child of dozens of amateur writers who wanted a place to "create" a world just as robust as Middle Earth or Westeros. At the start it was easily managed using a forum but as it's grown it has enough content to fill a couple hundred wiki pages with more added every week. Everything from fictional continents and countries to empire ending wars are apart of it's grand history.
* Description: This is the shared knowledge workframe for the IQT group at University of Sussex, including the sequences for the microfabrication, and the workflow tracking of microfabrications.
* Default language: ENen
[[User:Ratkoon|Ratkoon]] ([[User talk:Ratkoon|talk]]) 21:02, 3 August 2015 (BST)
 
<span class="plainlinks"><small>'''Stewards and wiki creators''': To create the requested wiki, click [{{fullurl:Special:CreateWiki|&wpdbname=Ashenmythwiki&wpcomment=Wiki+created+per+request+of+{{urlencode:Ratkoon}}&wpfounder={{urlencode:Ratkoon}}}} here]. Once the wiki has been created, [[Special:Userrights/Ratkoon@Ashenmythwiki|grant the local rights]]. (notify user: [{{fullurl:User talk:{{urlencode:Ratkoon}}|action=edit&section=new&preload=Template:Wiki_created}} done] · [{{fullurl:User talk:{{urlencode:Ratkoon}}|action=edit&section=new&preload=Wiki_not_created}} not done])</small></span>
Also, could you please add the extension "survey" to this wiki. thanks.
[[User:Ww9980|ww9980]] ([[User talk:Ww9980|talk]]) 19:05, 12 November 2014 (GMT)
 
== XenimusWiki <small>(Status: Pending)</small> ==
<small>'''Stewards and wiki creators''': To create the requested wiki, click [{{fullurl:Special:CreateWiki|Special:CreateWiki&wpdbname=iqtwiki&wpcomment=Wiki+created+per+request+of+{{urlencode:Ww9980}}&wpfounder={{urlencode:Ww9980}}}} here]. Once the wiki has been created, [[Special:Userrights/Ww9980@iqtwiki|grant the local rights]]. </small>
* Wiki ID: xenimuswiki
* URL: xenimus.orain.org
* Type: public
* File uploads: yes
* Description: a wiki for information and guides on Xenimus, an indie MMORPG created by EJ Thayer.
* Default language: en
[[User:BaraKing|BaraKing]] ([[User talk:BaraKing|talk]]) 00:50, 5 August 2015 (BST)
 
<span class="plainlinks"><small>'''Stewards and wiki creators''': To create the requested wiki, click [{{fullurl:Special:CreateWiki|&wpdbname=xenimuswiki&wpcomment=Wiki+created+per+request+of+{{urlencode:BaraKing}}&wpfounder={{urlencode:BaraKing}}}} here]. Once the wiki has been created, [[Special:Userrights/BaraKing@xenimuswiki|grant the local rights]]. (notify user: [{{fullurl:User talk:{{urlencode:BaraKing}}|action=edit&section=new&preload=Template:Wiki_created}} done] · [{{fullurl:User talk:{{urlencode:BaraKing}}|action=edit&section=new&preload=Wiki_not_created}} not done])</small></span>
 
== OsloReligious GründerHam <small>(Status: Pending)</small> ==
* Wiki ID: grunderwikireligioushamwiki
* URL: grunderreligiousham.orain.org
* Type: Private
* File uploads: yes
* Description: Religious Ham is a wiki project for a couple of my friends and I's original characters and lore. Has nothing to do with real religion or real food, and is purely fictional; it's named after the term 'Tasty Religious', a name that just stuck when we were playing the video game MySims. I had a MediaWiki LAN site set up before, but I couldn't keep hosting it because running a server was too complicated for me (doing maintenance and updating components, and breaking stuff in the process, and spending hours fixing them), so in the end I came here, hoping you guys would know how to do it right this time.
* Description: A wiki for start-ups in the Oslo area.
* Default language: noen
[[User:EtosFosterHaven|EtosFosterHaven]] ([[User talk:EtosFosterHaven|talk]]) 1009:3709, 137 NovemberAugust 20142015 (GMTBST)
 
<span class="plainlinks"><small>'''Stewards and wiki creators''': To create the requested wiki, click [{{fullurl:Special:CreateWiki|Special:CreateWiki&wpdbname=grunderwikireligioushamwiki&wpcomment=Wiki+created+per+request+of+{{urlencode:EtosFosterHaven}}&wpfounder={{urlencode:EtosFosterHaven}}}} here]. Once the wiki has been created, [[Special:Userrights/EtosFosterHaven@grunderwikireligioushamwiki|grant the local rights]]. (notify user: [{{fullurl:User talk:{{urlencode:FosterHaven}}|action=edit&section=new&preload=Template:Wiki_created}} done] · [{{fullurl:User talk:{{urlencode:FosterHaven}}|action=edit&section=new&preload=Wiki_not_created}} not done])</small></span>
 
== Semi-Realistic Feet Wiki ==
== fmucanat <small>(Status: Pending)</small> ==
 
* Wiki ID: fmucanatwiki
*Wiki ID: srfwwiki
* URL: fmucanat.orain.org
*URL: srfw.orain.org
* Type: Private
*Type: public
*File uploads: yes
*Description: Because why not?
*Default language: en
[[User:Blad|Blad]] ([[User talk:Blad|talk]]) 18:59, 1 April 2024 (UTC)
 
== Orain Test Wiki <small>(Status: Pending)</small> ==
* Wiki ID: testwiki
* URL: test.orain.org
* Type: Public
* File uploads: Yes
* Description: A wiki for testing admin and MediaWiki tools.
* Default language: en
[[User:Silicona|Silicona]] ([[User talk:Silicona|talk]]) 12:26, 2 April 2024 (UTC)
 
<span class="plainlinks"><small>'''Stewards and wiki creators''': To create the requested wiki, click [{{fullurl:Special:CreateWiki|&wpdbname=testwiki&wpcomment=Wiki+created+per+request+of+{{urlencode:Silicona}}&wpfounder={{urlencode:Silicona}}}} here]. Once the wiki has been created, [[Special:Userrights/Silicona@testwiki|grant the local rights]]. (notify user: [{{fullurl:User talk:{{urlencode:Silicona}}|action=edit&section=new&preload=Template:Wiki_created}} done] · [{{fullurl:User talk:{{urlencode:Silicona}}|action=edit&section=new&preload=Wiki_not_created}} not done])</small></span>
 
== <nowiki>{{{title}}}</nowiki> Wiki <small>(Status: Pending)</small> ==
* Wiki ID: title.orain.orgwiki
* URL: title.orain.org.orain.org
* Type: Public
* File uploads: yes
* Description: nothing, I'll just call it the <nowiki>{{{title}}}</nowiki> Wiki, just as a funny wiki name, literally just that
* Description: This wiki is intended to serve as a complete and updated database for students taking Anatomy at the Faculty of Medicine - University of Coimbra. The wiki will be in Portuguese (Portugal).
* Default language: pten
[[User:E samartaJustLeafy2k3|E samartaJustLeafy2k3]] ([[User talk:E samartaJustLeafy2k3|talk]]) 1918:2433, 133 NovemberApril 20142024 (GMTUTC)
 
<span class="plainlinks"><small>'''Stewards and wiki creators''': To create the requested wiki, click [{{fullurl:Special:CreateWiki|&wpdbname=title.orain.orgwiki&wpcomment=Wiki+created+per+request+of+{{urlencode:JustLeafy2k3}}&wpfounder={{urlencode:JustLeafy2k3}}}} here]. Once the wiki has been created, [[Special:Userrights/JustLeafy2k3@title.orain.orgwiki|grant the local rights]]. (notify user: [{{fullurl:User talk:{{urlencode:JustLeafy2k3}}|action=edit&section=new&preload=Template:Wiki_created}} done] · [{{fullurl:User talk:{{urlencode:JustLeafy2k3}}|action=edit&section=new&preload=Wiki_not_created}} not done])</small></span>
 
== LGDC wiki <small>(Status: Pending)</small> ==
* Wiki ID: lgdcwiki
* URL: lgdc.orain.org
* Type: Public
* File uploads: Yes
* Description: FR wiki for Warriors of Erin Hunter.
* Default language: fr
[[User:Rafdodo|Rafdodo]] ([[User talk:Rafdodo|talk]]) 17:29, 4 April 2024 (UTC)
 
<span class="plainlinks"><small>'''Stewards and wiki creators''': To create the requested wiki, click [{{fullurl:Special:CreateWiki|Special:CreateWiki&wpdbname=fmucanatwikilgdcwiki&wpcomment=Wiki+created+per+request+of+{{urlencode:E samartaRafdodo}}&wpfounder={{urlencode:E samartaRafdodo}}}} here]. Once the wiki has been created, [[Special:Userrights/E samartaRafdodo@fmucanatwikilgdcwiki|grant the local rights]]. (notify user: [{{fullurl:User talk:{{urlencode:Rafdodo}}|action=edit&section=new&preload=Template:Wiki_created}} done] · [{{fullurl:User talk:{{urlencode:Rafdodo}}|action=edit&section=new&preload=Wiki_not_created}} not done])</small></span>